| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [256117] (1 PDB entry) |
| Domain d3uamd_: 3uam D: [343880] automated match to d5lw4a_ complexed with gol, no3 |
PDB Entry: 3uam (more details), 2 Å
SCOPe Domain Sequences for d3uamd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uamd_ b.1.18.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
isprhgrvitpesravylyeagrldfgqvneleggkffpatqsglrdpdapddvangmpp
rdgeiasggrtadaraqlnepdsvahwqkhavrsgqslqiswsysmphktrrwtywitkp
gwdtqarlarahfepdplkvylntyqpywgpdadkelipqgetihefnlptrtgyhvlla
vwdvadtanafyqvidlnfa
Timeline for d3uamd_: