Lineage for d3tate_ (3tat E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895181Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species)
  7. 2895189Species Escherichia coli [TaxId:562] [53394] (1 PDB entry)
  8. 2895194Domain d3tate_: 3tat E: [34383]
    complexed with plp

Details for d3tate_

PDB Entry: 3tat (more details), 3.5 Å

PDB Description: tyrosine aminotransferase from e. coli
PDB Compounds: (E:) Tyrosine aminotransferase

SCOPe Domain Sequences for d3tate_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tate_ c.67.1.1 (E:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]}
mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
rlreefgvyliasgrmcvaglntanvqrvakafaavm

SCOPe Domain Coordinates for d3tate_:

Click to download the PDB-style file with coordinates for d3tate_.
(The format of our PDB-style files is described here.)

Timeline for d3tate_: