![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [53394] (1 PDB entry) |
![]() | Domain d3tatc_: 3tat C: [34381] complexed with plp |
PDB Entry: 3tat (more details), 3.5 Å
SCOPe Domain Sequences for d3tatc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tatc_ c.67.1.1 (C:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd rlreefgvyliasgrmcvaglntanvqrvakafaavm
Timeline for d3tatc_: