Lineage for d3tatc_ (3tat C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705347Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 705355Species Escherichia coli [TaxId:562] [53394] (1 PDB entry)
  8. 705358Domain d3tatc_: 3tat C: [34381]

Details for d3tatc_

PDB Entry: 3tat (more details), 3.5 Å

PDB Description: tyrosine aminotransferase from e. coli
PDB Compounds: (C:) Tyrosine aminotransferase

SCOP Domain Sequences for d3tatc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tatc_ c.67.1.1 (C:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]}
mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
rlreefgvyliasgrmcvaglntanvqrvakafaavm

SCOP Domain Coordinates for d3tatc_:

Click to download the PDB-style file with coordinates for d3tatc_.
(The format of our PDB-style files is described here.)

Timeline for d3tatc_: