SCOP 1.71: Domain d3tatc_: 3tat C:

Lineage for d3tatc_ (3tat C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (6 families)

5. Family c.67.1.1: AAT-like [53384] (12 proteins)

6. Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)

7. Species Escherichia coli [TaxId:562] [53394] (1 PDB entry)

8. Domain d3tatc_: 3tat C: [34381]

Details for d3tatc_

PDB Entry: 3tat, 3.5 Å

PDB Description: tyrosine aminotransferase from e. coli

SCOP Domain Sequences for d3tatc_:

Sequence; same for both SEQRES and ATOM records:

>d3tatc_ c.67.1.1 (C:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli}
mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
rlreefgvyliasgrmcvaglntanvqrvakafaavm

Timeline for d3tatc_:

• d3tatc_ first appeared (with stable ids) in SCOP 1.55
  
• d3tatc_ appears in SCOP 1.69
  
• d3tatc_ appears in SCOP 1.73
  
• d3tatc_ appears in the current release, SCOPe 2.08