SCOPe 2.08: Domain d3g6ab1: 3g6a B:1-122

Lineage for d3g6ab1 (3g6a B:1-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d3g6ab1: 3g6a B:1-122 [343794]
   Other proteins in same PDB: d3g6aa1, d3g6aa2, d3g6ab2, d3g6ah2, d3g6al1, d3g6al2
   automated match to d3g6dh1

Details for d3g6ab1

PDB Entry: 3g6a, 2.1 Å

PDB Description: Crystal structure of anti-IL-13 antibody CNTO607

PDB Compounds: (B:) CNTO607 Fab Heavy chain

SCOPe Domain Sequences for d3g6ab1:

Sequence; same for both SEQRES and ATOM records:

>d3g6ab1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
ss

Timeline for d3g6ab1:

• d3g6ab1 first appeared in SCOPe 2.07