![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Streptococcus thermophilus [TaxId:264199] [311279] (1 PDB entry) |
![]() | Domain d3e58b1: 3e58 B:1-211 [343790] Other proteins in same PDB: d3e58b2 automated match to d3e58a_ complexed with gol, so4 |
PDB Entry: 3e58 (more details), 1.86 Å
SCOPe Domain Sequences for d3e58b1:
Sequence, based on SEQRES records: (download)
>d3e58b1 c.108.1.0 (B:1-211) automated matches {Streptococcus thermophilus [TaxId: 264199]} mveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiggntkqvwenilrdey dkwdvstlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadifral eenrlqgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagvaadv evwairdnefgmdqsaakglldsltdvldli
>d3e58b1 c.108.1.0 (B:1-211) automated matches {Streptococcus thermophilus [TaxId: 264199]} mveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiqvwenilrdeydkwdv stlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadifraleenrl qgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagvaadvevwai rdnefgmdqsaakglldsltdvldli
Timeline for d3e58b1: