SCOPe 2.08: Domain d3dsad1: 3dsa D:1-139

Lineage for d3dsad1 (3dsa D:1-139)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.133: RbsD-like [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: RbsD-like [102546] (2 families)

5. Family c.133.1.0: automated matches [191558] (1 protein)
   not a true family

6. Protein automated matches [190962] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [346345] (1 PDB entry)

8. Domain d3dsad1: 3dsa D:1-139 [343786]
   Other proteins in same PDB: d3dsaa2, d3dsab2, d3dsac2, d3dsad2, d3dsae2, d3dsaf2, d3dsag2, d3dsah2, d3dsai2, d3dsao2
   automated match to d1ogda_
   complexed with edo

Details for d3dsad1

PDB Entry: 3dsa, 2.45 Å

PDB Description: Crystal structure of D-ribose high-affinity transport system from Salmonella typhimurium LT2

PDB Compounds: (D:) D-ribose high-affinity transport system

SCOPe Domain Sequences for d3dsad1:

Sequence; same for both SEQRES and ATOM records:

>d3dsad1 c.133.1.0 (D:1-139) automated matches {Salmonella typhimurium [TaxId: 602]}
mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtr
emqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavi
rsgecspyanvilcagvtf

Timeline for d3dsad1:

• d3dsad1 first appeared in SCOPe 2.07