Lineage for d2ay9b_ (2ay9 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589120Family c.67.1.1: AAT-like [53384] (12 proteins)
  6. 589125Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 589140Species Paracoccus denitrificans [TaxId:266] [53393] (12 PDB entries)
  8. 589164Domain d2ay9b_: 2ay9 B: [34378]
    complexed with 5pv, plp

Details for d2ay9b_

PDB Entry: 2ay9 (more details), 2.5 Å

PDB Description: aromatic amino acid aminotransferase with 5-phenylvaleric acid

SCOP Domain Sequences for d2ay9b_:

Sequence, based on SEQRES records: (download)

>d2ay9b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans}
mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
efgiymvgdsriniaglndntipilaraiievgv

Sequence, based on observed residues (ATOM records): (download)

>d2ay9b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans}
mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
vgdsriniaglndntipilaraiievgv

SCOP Domain Coordinates for d2ay9b_:

Click to download the PDB-style file with coordinates for d2ay9b_.
(The format of our PDB-style files is described here.)

Timeline for d2ay9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ay9a_