Lineage for d2gztc_ (2gzt C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615267Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 2615268Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 2615269Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 2615270Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 2615271Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
    Uniprot P10943
  8. 2615273Domain d2gztc_: 2gzt C: [343676]
    automated match to d3boya_
    protein/RNA complex; complexed with his, mg

Details for d2gztc_

PDB Entry: 2gzt (more details), 1.7 Å

PDB Description: Crystal structure of the HutP antitermination complex bound to the HUT mRNA
PDB Compounds: (C:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d2gztc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gztc_ d.275.1.1 (C:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d2gztc_:

Click to download the PDB-style file with coordinates for d2gztc_.
(The format of our PDB-style files is described here.)

Timeline for d2gztc_: