Lineage for d2gk1.5 (2gk1 B:,M:122-199)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571710Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2571727Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 2571728Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 2571745Domain d2gk1.5: 2gk1 B:,M:122-199 [343662]
    Other proteins in same PDB: d2gk1.1, d2gk1.2, d2gk1.3, d2gk1.4, d2gk1.9, d2gk1.a, d2gk1.b, d2gk1.c, d2gk1i1, d2gk1j1, d2gk1k1, d2gk1l1
    automatically matched to d1o7aa2
    complexed with bma, nag, ngt

Details for d2gk1.5

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (B:) Beta-hexosaminidase subunit beta, (M:) Beta-hexosaminidase subunit beta chain B

SCOPe Domain Sequences for d2gk1.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g2gk1.5 d.92.2.1 (B:,M:122-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgXtqvqq
llvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygt
ftinestiidspr

SCOPe Domain Coordinates for d2gk1.5:

Click to download the PDB-style file with coordinates for d2gk1.5.
(The format of our PDB-style files is described here.)

Timeline for d2gk1.5:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gk1.9
View in 3D
Domains from other chains:
(mouse over for more information)
d2gk1.1, d2gk1.1, d2gk1.1, d2gk1.1, d2gk1.2, d2gk1.2, d2gk1.2, d2gk1.2, d2gk1.3, d2gk1.3, d2gk1.3, d2gk1.3, d2gk1.4, d2gk1.4, d2gk1.4, d2gk1.4, d2gk1.6, d2gk1.6, d2gk1.6, d2gk1.6, d2gk1.7, d2gk1.7, d2gk1.7, d2gk1.7, d2gk1.8, d2gk1.8, d2gk1.8, d2gk1.8, d2gk1.9, d2gk1.9, d2gk1.9, d2gk1.a, d2gk1.a, d2gk1.a, d2gk1.a, d2gk1.b, d2gk1.b, d2gk1.b, d2gk1.b, d2gk1.c, d2gk1.c, d2gk1.c, d2gk1.c, d2gk1i1, d2gk1i1, d2gk1j1, d2gk1j1, d2gk1k1, d2gk1k1, d2gk1l1, d2gk1l1