Lineage for d2f9dq_ (2f9d Q:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047758Fold j.148: Splicing factor 3B subunit 1 fragment [345912] (1 superfamily)
  4. 3047759Superfamily j.148.1: Splicing factor 3B subunit 1 fragment [345948] (1 family) (S)
    Pfam PF08920
  5. 3047760Family j.148.1.1: Splicing factor 3B subunit 1 fragment [346006] (1 protein)
  6. 3047761Protein Splicing factor 3B subunit 1 fragment [346149] (1 species)
  7. 3047762Species Human (Homo sapiens) [TaxId:9606] [346468] (1 PDB entry)
  8. 3047764Domain d2f9dq_: 2f9d Q: [343649]
    Other proteins in same PDB: d2f9da1, d2f9db_

Details for d2f9dq_

PDB Entry: 2f9d (more details), 2.5 Å

PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
PDB Compounds: (Q:) Splicing factor 3B subunit 1

SCOPe Domain Sequences for d2f9dq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9dq_ j.148.1.1 (Q:) Splicing factor 3B subunit 1 fragment {Human (Homo sapiens) [TaxId: 9606]}
smtpeqlqawrwereidernrplsdeeldamfpegykvl

SCOPe Domain Coordinates for d2f9dq_:

Click to download the PDB-style file with coordinates for d2f9dq_.
(The format of our PDB-style files is described here.)

Timeline for d2f9dq_: