Lineage for d2ay6b_ (2ay6 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26198Family c.67.1.1: AAT-like [53384] (3 proteins)
  6. 26199Protein Aromatic aminoacid aminotransferase, AroAT [53392] (2 species)
  7. 26207Species Paracoccus denitrificans [TaxId:266] [53393] (12 PDB entries)
  8. 26215Domain d2ay6b_: 2ay6 B: [34364]

Details for d2ay6b_

PDB Entry: 2ay6 (more details), 2.2 Å

PDB Description: aromatic amino acid aminotransferase with 3-indolebutyric acid

SCOP Domain Sequences for d2ay6b_:

Sequence, based on SEQRES records: (download)

>d2ay6b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans}
mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
efgiymvgdsriniaglndntipilaraiievgv

Sequence, based on observed residues (ATOM records): (download)

>d2ay6b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans}
mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
vgdsriniaglndntipilaraiievgv

SCOP Domain Coordinates for d2ay6b_:

Click to download the PDB-style file with coordinates for d2ay6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ay6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ay6a_