Lineage for d2ay6b_ (2ay6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131005Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species)
  7. 2131020Species Paracoccus denitrificans [TaxId:266] [53393] (12 PDB entries)
  8. 2131030Domain d2ay6b_: 2ay6 B: [34364]
    complexed with 3ib, plp

Details for d2ay6b_

PDB Entry: 2ay6 (more details), 2.2 Å

PDB Description: aromatic amino acid aminotransferase with 3-indolebutyric acid
PDB Compounds: (B:) aromatic amino acid aminotransferase

SCOPe Domain Sequences for d2ay6b_:

Sequence, based on SEQRES records: (download)

>d2ay6b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]}
mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
efgiymvgdsriniaglndntipilaraiievgv

Sequence, based on observed residues (ATOM records): (download)

>d2ay6b_ c.67.1.1 (B:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]}
mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
vgdsriniaglndntipilaraiievgv

SCOPe Domain Coordinates for d2ay6b_:

Click to download the PDB-style file with coordinates for d2ay6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ay6b_: