Lineage for d2ay7a_ (2ay7 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840469Protein Aromatic aminoacid aminotransferase, AroAT [53392] (3 species)
  7. 840484Species Paracoccus denitrificans [TaxId:266] [53393] (12 PDB entries)
  8. 840493Domain d2ay7a_: 2ay7 A: [34361]

Details for d2ay7a_

PDB Entry: 2ay7 (more details), 2.4 Å

PDB Description: aromatic amino acid aminotransferase with 4-phenylbutyric acid
PDB Compounds: (A:) aromatic amino acid aminotransferase

SCOP Domain Sequences for d2ay7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ay7a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]}
mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
efgiymvgdsriniaglndntipilaraiievgv

SCOP Domain Coordinates for d2ay7a_:

Click to download the PDB-style file with coordinates for d2ay7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ay7a_: