SCOPe 2.08: Domain d1np0.4: 1np0 E:200-311,F:

Lineage for d1np0.4 (1np0 E:200-311,F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
   Glycosyl hydrolase family 20, GH20
   automatically mapped to Pfam PF00728

6. Protein beta-hexosaminidase B [89486] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)

8. Domain d1np0.4: 1np0 E:200-311,F: [343545]
   Other proteins in same PDB: d1np0.1, d1np0.2
   complexed with gol, ngt, so4

Details for d1np0.4

PDB Entry: 1np0, 2.5 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline

PDB Compounds: (E:) Beta-hexosaminidase subunit beta chain B, (F:) Beta-hexosaminidase subunit beta chain A

SCOPe Domain Sequences for d1np0.4:

Sequence; same for both SEQRES and ATOM records:

>g1np0.4 c.1.8.6 (E:200-311,F:) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysXldsfgpi
nptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkk
lesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfp
vilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprl
wprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Timeline for d1np0.4:

• d1np0.4 first appeared in SCOPe 2.07