Lineage for d1np0.3 (1np0 C:200-311,D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440644Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2440661Protein beta-hexosaminidase B [89486] (1 species)
  7. 2440662Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2440673Domain d1np0.3: 1np0 C:200-311,D: [343544]
    Other proteins in same PDB: d1np0.1, d1np0.2
    complexed with gol, nag, ngt, so4

Details for d1np0.3

PDB Entry: 1np0 (more details), 2.5 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline
PDB Compounds: (C:) Beta-hexosaminidase subunit beta chain B, (D:) Beta-hexosaminidase subunit beta chain A

SCOPe Domain Sequences for d1np0.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1np0.3 c.1.8.6 (C:200-311,D:) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysXldsfgpi
nptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkk
lesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfp
vilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprl
wprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d1np0.3:

Click to download the PDB-style file with coordinates for d1np0.3.
(The format of our PDB-style files is described here.)

Timeline for d1np0.3: