Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries) |
Domain d1np0.2: 1np0 B:,E:122-199 [343543] Other proteins in same PDB: d1np0.3, d1np0.4 complexed with gol, ngt, so4 |
PDB Entry: 1np0 (more details), 2.5 Å
SCOPe Domain Sequences for d1np0.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1np0.2 d.92.2.1 (B:,E:122-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgXtqvqql lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf tinestiidspr
Timeline for d1np0.2: