Lineage for d1np0.1 (1np0 A:,C:122-199)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965097Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2965114Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 2965115Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 2965126Domain d1np0.1: 1np0 A:,C:122-199 [343542]
    Other proteins in same PDB: d1np0.3, d1np0.4
    complexed with gol, ngt, so4

Details for d1np0.1

PDB Entry: 1np0 (more details), 2.5 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline
PDB Compounds: (A:) Beta-hexosaminidase subunit beta, (C:) Beta-hexosaminidase subunit beta chain B

SCOPe Domain Sequences for d1np0.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1np0.1 d.92.2.1 (A:,C:122-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgXtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOPe Domain Coordinates for d1np0.1:

Click to download the PDB-style file with coordinates for d1np0.1.
(The format of our PDB-style files is described here.)

Timeline for d1np0.1: