SCOPe 2.08: Domain d1np0.1: 1np0 A:,C:122-199

Lineage for d1np0.1 (1np0 A:,C:122-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)

8. Domain d1np0.1: 1np0 A:,C:122-199 [343542]
   Other proteins in same PDB: d1np0.3, d1np0.4
   complexed with gol, ngt, so4

Details for d1np0.1

PDB Entry: 1np0, 2.5 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline

PDB Compounds: (A:) Beta-hexosaminidase subunit beta, (C:) Beta-hexosaminidase subunit beta chain B

SCOPe Domain Sequences for d1np0.1:

Sequence; same for both SEQRES and ATOM records:

>g1np0.1 d.92.2.1 (A:,C:122-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgXtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

Timeline for d1np0.1:

• d1np0.1 first appeared in SCOPe 2.07