SCOPe 2.08: Domain d1miub_: 1miu B:

Lineage for d1miub_ (1miu B:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.136: SEM1 fragments [345900] (1 superfamily)

4. Superfamily j.136.1: SEM1 fragments [345936] (1 family)

5. Family j.136.1.1: SEM1 fragments [345994] (1 protein)

6. Protein SEM1 fragment [346137] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [346453] (1 PDB entry)

8. Domain d1miub_: 1miu B: [343528]
   Other proteins in same PDB: d1miua1, d1miua2, d1miua3, d1miua4, d1miua5
   protein/DNA complex; complexed with hg

Details for d1miub_

PDB Entry: 1miu, 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex

PDB Compounds: (B:) Deleted in split hand/split foot protein 1

SCOPe Domain Sequences for d1miub_:

Sequence, based on SEQRES records:

>d1miub_ j.136.1.1 (B:) SEM1 fragment {Human (Homo sapiens) [TaxId: 9606]}
pvdlglleeddefeefpaedwagldededahvwednwdddnveddfsnqlraelekh

Sequence, based on observed residues (ATOM records):

>d1miub_ j.136.1.1 (B:) SEM1 fragment {Human (Homo sapiens) [TaxId: 9606]}
pvdlglleeddefeefpaehvwednwddddfsnqlraelekh

Timeline for d1miub_:

• d1miub_ first appeared in SCOPe 2.07