Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries) |
Domain d1liya6: 1liy A:440-573 [343520] Other proteins in same PDB: d1liya4, d1liya5, d1liyb4, d1liyc4, d1liyc5, d1liyd4, d1liyd5 automated match to d2vgga3 complexed with fbp, k, mn, pga; mutant |
PDB Entry: 1liy (more details), 2.74 Å
SCOPe Domain Sequences for d1liya6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liya6 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} elrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsryrpraaviavtrs aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr pgsgytnimrvlsi
Timeline for d1liya6: