Lineage for d1lixd5 (1lix D:160-261)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413578Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2413579Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2413580Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2413581Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2413602Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries)
  8. 2413629Domain d1lixd5: 1lix D:160-261 [343516]
    Other proteins in same PDB: d1lixa4, d1lixa6, d1lixb4, d1lixb5, d1lixc4, d1lixc6, d1lixd4, d1lixd6
    automated match to d2vgia1
    complexed with fbp, k, mn, pga; mutant

Details for d1lixd5

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
PDB Compounds: (D:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1lixd5:

Sequence, based on SEQRES records: (download)

>d1lixd5 b.58.1.1 (D:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

Sequence, based on observed residues (ATOM records): (download)

>d1lixd5 b.58.1.1 (D:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddgl
islvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOPe Domain Coordinates for d1lixd5:

Click to download the PDB-style file with coordinates for d1lixd5.
(The format of our PDB-style files is described here.)

Timeline for d1lixd5: