Lineage for d1jncd_ (1jnc D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2473291Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2473292Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2473293Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2473340Domain d1jncd_: 1jnc D: [343482]
    Other proteins in same PDB: d1jnca_, d1jncb2, d1jncc_
    automated match to d1fgxb_
    complexed with ca, gud, mn

Details for d1jncd_

PDB Entry: 1jnc (more details), 2.3 Å

PDB Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and UDP-glucose
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1jncd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jncd_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1jncd_:

Click to download the PDB-style file with coordinates for d1jncd_.
(The format of our PDB-style files is described here.)

Timeline for d1jncd_:

  • d1jncd_ is new in SCOPe 2.07-stable