Lineage for d2aata_ (2aat A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147133Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2147168Species Escherichia coli [TaxId:562] [53390] (84 PDB entries)
    Uniprot P00509
  8. 2147276Domain d2aata_: 2aat A: [34348]
    complexed with pmp, so4; mutant

Details for d2aata_

PDB Entry: 2aat (more details), 2.8 Å

PDB Description: 2.8-angstroms-resolution crystal structure of an active-site mutant of aspartate aminotransferase from escherichia coli
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d2aata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysanfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d2aata_:

Click to download the PDB-style file with coordinates for d2aata_.
(The format of our PDB-style files is described here.)

Timeline for d2aata_: