Lineage for d1aam__ (1aam -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589120Family c.67.1.1: AAT-like [53384] (12 proteins)
  6. 589165Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 589199Species Escherichia coli [TaxId:562] [53390] (57 PDB entries)
  8. 589273Domain d1aam__: 1aam - [34347]
    complexed with plp, so4; mutant

Details for d1aam__

PDB Entry: 1aam (more details), 2.8 Å

PDB Description: the structural basis for the altered substrate specificity of the r292d active site mutant of aspartate aminotransferase from e. coli

SCOP Domain Sequences for d1aam__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aam__ c.67.1.1 (-) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaaidanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1aam__:

Click to download the PDB-style file with coordinates for d1aam__.
(The format of our PDB-style files is described here.)

Timeline for d1aam__: