Lineage for d1asfa_ (1asf A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840509Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 840544Species Escherichia coli [TaxId:562] [53390] (62 PDB entries)
    Uniprot P00509
  8. 840622Domain d1asfa_: 1asf A: [34345]
    complexed with plp, so4; mutant

Details for d1asfa_

PDB Entry: 1asf (more details), 2.8 Å

PDB Description: the structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d1asfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asfa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfafqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1asfa_:

Click to download the PDB-style file with coordinates for d1asfa_.
(The format of our PDB-style files is described here.)

Timeline for d1asfa_: