Lineage for d1asf__ (1asf -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 490723Family c.67.1.1: AAT-like [53384] (10 proteins)
  6. 490768Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 490802Species Escherichia coli [TaxId:562] [53390] (52 PDB entries)
  8. 490869Domain d1asf__: 1asf - [34345]

Details for d1asf__

PDB Entry: 1asf (more details), 2.8 Å

PDB Description: the structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase

SCOP Domain Sequences for d1asf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asf__ c.67.1.1 (-) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfafqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1asf__:

Click to download the PDB-style file with coordinates for d1asf__.
(The format of our PDB-style files is described here.)

Timeline for d1asf__: