Lineage for d5wk3v2 (5wk3 V:113-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750423Domain d5wk3v2: 5wk3 V:113-217 [343367]
    Other proteins in same PDB: d5wk3a_, d5wk3b_, d5wk3c_, d5wk3d_, d5wk3p1, d5wk3q_, d5wk3r1, d5wk3s_, d5wk3t1, d5wk3u_, d5wk3v1, d5wk3w_
    automated match to d1dn0a2
    complexed with gol

Details for d5wk3v2

PDB Entry: 5wk3 (more details), 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab
PDB Compounds: (V:) m116 light chain

SCOPe Domain Sequences for d5wk3v2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wk3v2 b.1.1.2 (V:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5wk3v2:

Click to download the PDB-style file with coordinates for d5wk3v2.
(The format of our PDB-style files is described here.)

Timeline for d5wk3v2: