SCOPe 2.08: Domain d5xhgb2: 5xhg B:121-220

Lineage for d5xhgb2 (5xhg B:121-220)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Escherichia coli [TaxId:316407] [343348] (1 PDB entry)

8. Domain d5xhgb2: 5xhg B:121-220 [343363]
   Other proteins in same PDB: d5xhga1, d5xhga2, d5xhgb1, d5xhgc1, d5xhgc2, d5xhgd1
   automated match to d1n8zb2
   complexed with edo, oaz, peg, so4

Details for d5xhgb2

PDB Entry: 5xhg, 1.76 Å

PDB Description: crystal structure of trastuzumab fab fragment bearing ne-(o- azidobenzyloxycarbonyl)-l-lysine

PDB Compounds: (B:) polypeptide(H)

SCOPe Domain Sequences for d5xhgb2:

Sequence, based on SEQRES records:

>d5xhgb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 316407]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d5xhgb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 316407]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d5xhgb2:

• d5xhgb2 first appeared in SCOPe 2.06
  
• d5xhgb2 appears in SCOPe 2.07