SCOPe 2.06: Domain d5xt5a1: 5xt5 A:1-404

Lineage for d5xt5a1 (5xt5 A:1-404)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [320074] (2 PDB entries)

8. Domain d5xt5a1: 5xt5 A:1-404 [343357]
   Other proteins in same PDB: d5xt5a2, d5xt5c_, d5xt5d_
   automated match to d4lw2a_
   complexed with plp, zn

Details for d5xt5a1

PDB Entry: 5xt5, 2.34 Å

PDB Description: sufs-sufu complex from bacillus subtilis

PDB Compounds: (A:) Cysteine desulfurase SufS

SCOPe Domain Sequences for d5xt5a1:

Sequence; same for both SEQRES and ATOM records:

>d5xt5a1 c.67.1.0 (A:1-404) automated matches {Bacillus subtilis [TaxId: 224308]}
mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
caqplmkwldvtatarasfylynteeeidklvealqktkeyftn

Timeline for d5xt5a1:

• d5xt5a1 is new in SCOPe 2.06-stable
  
• d5xt5a1 appears in SCOPe 2.07
  
• d5xt5a1 appears in the current release, SCOPe 2.08