Lineage for d5xg0a1 (5xg0 A:1-261)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153086Species Ideonella sakaiensis [TaxId:1547922] [343272] (5 PDB entries)
  8. 2153091Domain d5xg0a1: 5xg0 A:1-261 [343354]
    Other proteins in same PDB: d5xg0a2, d5xg0b2, d5xg0c2
    automated match to d4eb0a_

Details for d5xg0a1

PDB Entry: 5xg0 (more details), 1.58 Å

PDB Description: crystal structure of a novel pet hydrolase from ideonella sakaiensis 201-f6
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d5xg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xg0a1 c.69.1.0 (A:1-261) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygkv
dtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d5xg0a1:

Click to download the PDB-style file with coordinates for d5xg0a1.
(The format of our PDB-style files is described here.)

Timeline for d5xg0a1: