![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Escherichia coli [TaxId:316407] [343346] (1 PDB entry) |
![]() | Domain d5xhgd1: 5xhg D:1-120 [343347] Other proteins in same PDB: d5xhga1, d5xhga2, d5xhgb2, d5xhgc1, d5xhgc2, d5xhgd2 automated match to d1n8zb1 complexed with edo, oaz, peg, so4 |
PDB Entry: 5xhg (more details), 1.76 Å
SCOPe Domain Sequences for d5xhgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xhgd1 b.1.1.1 (D:1-120) Immunoglobulin heavy chain variable domain, VH {Escherichia coli [TaxId: 316407]} evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdywgqgtlvtvss
Timeline for d5xhgd1: