SCOPe 2.08: Domain d5wyrb1: 5wyr B:5-250

Lineage for d5wyrb1 (5wyr B:5-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
   fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain

6. Protein automated matches [196235] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [343276] (7 PDB entries)

8. Domain d5wyrb1: 5wyr B:5-250 [343344]
   Other proteins in same PDB: d5wyra2, d5wyrb2
   automated match to d1p9pa_
   complexed with sfg

Details for d5wyrb1

PDB Entry: 5wyr, 2.45 Å

PDB Description: crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa

PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d5wyrb1:

Sequence; same for both SEQRES and ATOM records:

>d5wyrb1 c.116.1.4 (B:5-250) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
lwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggpgm
vmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryegid
erfieehvdeewsigdyvlsggelpamvlvdavtrllpgalghadsaeedsftdglldcp
hytrpevyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllae
yirqrd

Timeline for d5wyrb1:

• d5wyrb1 first appeared in SCOPe 2.06
  
• d5wyrb1 appears in SCOPe 2.07