SCOPe 2.07: Domain d5yxca_: 5yxc A:

Lineage for d5yxca_ (5yxc A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
   bacterial metal-binding, lipocalin-like protein
   automatically mapped to Pfam PF09223

6. Protein Hypothetical protein YodA [101864] (3 species)

7. Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
   Uniprot P76344

8. Domain d5yxca_: 5yxc A: [343343]
   automated match to d1s7da_
   complexed with cit, zn

Details for d5yxca_

PDB Entry: 5yxc, 1.76 Å

PDB Description: crystal structure of zinc binding protein zint in complex with citrate from e. coli

PDB Compounds: (A:) metal-binding protein zint

SCOPe Domain Sequences for d5yxca_:

Sequence; same for both SEQRES and ATOM records:

>d5yxca_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

Timeline for d5yxca_:

• d5yxca_ first appeared in SCOPe 2.06
  
• d5yxca_ appears in the current release, SCOPe 2.08