Lineage for d5mkno_ (5mkn O:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057725Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2057726Protein automated matches [190914] (13 species)
    not a true protein
  7. 2057865Species Methanococcus vannielii [TaxId:2187] [343057] (1 PDB entry)
  8. 2057880Domain d5mkno_: 5mkn O: [343342]
    automated match to d1mgqa_
    complexed with pg4, u5p

Details for d5mkno_

PDB Entry: 5mkn (more details), 2.55 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii
PDB Compounds: (O:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mkno_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkno_ b.38.1.0 (O:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
vrgdnvlyvsl

SCOPe Domain Coordinates for d5mkno_:

Click to download the PDB-style file with coordinates for d5mkno_.
(The format of our PDB-style files is described here.)

Timeline for d5mkno_: