![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins) bacterial metal-binding, lipocalin-like protein automatically mapped to Pfam PF09223 |
![]() | Protein Hypothetical protein YodA [101864] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [101865] (6 PDB entries) Uniprot P76344 |
![]() | Domain d5yxcb_: 5yxc B: [343338] automated match to d1s7da_ complexed with cit, zn |
PDB Entry: 5yxc (more details), 1.76 Å
SCOPe Domain Sequences for d5yxcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yxcb_ b.60.1.4 (B:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]} gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev veemmsh
Timeline for d5yxcb_: