Lineage for d5yxcb_ (5yxc B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805489Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2805490Protein Hypothetical protein YodA [101864] (3 species)
  7. 2805493Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
    Uniprot P76344
  8. 2805499Domain d5yxcb_: 5yxc B: [343338]
    automated match to d1s7da_
    complexed with cit, zn

Details for d5yxcb_

PDB Entry: 5yxc (more details), 1.76 Å

PDB Description: crystal structure of zinc binding protein zint in complex with citrate from e. coli
PDB Compounds: (B:) metal-binding protein zint

SCOPe Domain Sequences for d5yxcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxcb_ b.60.1.4 (B:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

SCOPe Domain Coordinates for d5yxcb_:

Click to download the PDB-style file with coordinates for d5yxcb_.
(The format of our PDB-style files is described here.)

Timeline for d5yxcb_: