SCOPe 2.08: Domain d6ap4h3: 6ap4 H:261-380

Lineage for d6ap4h3 (6ap4 H:261-380)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [342941] (1 PDB entry)

8. Domain d6ap4h3: 6ap4 H:261-380 [343335]
   Other proteins in same PDB: d6ap4a4, d6ap4b4, d6ap4c4, d6ap4d4, d6ap4e4, d6ap4f4, d6ap4g4, d6ap4h4, d6ap4i4, d6ap4j4, d6ap4l4, d6ap4m4, d6ap4n4, d6ap4o4, d6ap4p4
   automated match to d4tr8a3
   complexed with mg

Details for d6ap4h3

PDB Entry: 6ap4, 2.95 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from acinetobacter baumannii

PDB Compounds: (H:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6ap4h3:

Sequence; same for both SEQRES and ATOM records:

>d6ap4h3 d.131.1.0 (H:261-380) automated matches {Acinetobacter baumannii [TaxId: 470]}
rrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqdeaie
dlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahpdqtyvvmpm

Timeline for d6ap4h3:

• d6ap4h3 first appeared in SCOPe 2.06
  
• d6ap4h3 appears in SCOPe 2.07