Lineage for d5xh2a1 (5xh2 A:1-260)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902426Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2902430Domain d5xh2a1: 5xh2 A:1-260 [343331]
    Other proteins in same PDB: d5xh2a2
    automated match to d4eb0a_
    complexed with npo, so4; mutant

Details for d5xh2a1

PDB Entry: 5xh2 (more details), 1.2 Å

PDB Description: crystal structure of a novel pet hydrolase r103g/s131a mutant in complex with pnp from ideonella sakaiensis 201-f6
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d5xh2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xh2a1 c.69.1.0 (A:1-260) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalgqvaslngtssspiygkv
dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtanc

SCOPe Domain Coordinates for d5xh2a1:

Click to download the PDB-style file with coordinates for d5xh2a1.
(The format of our PDB-style files is described here.)

Timeline for d5xh2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xh2a2