Lineage for d5xhga1 (5xhg A:1-106)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (29 species)
not a true protein
Species Escherichia coli [TaxId:316407] [343294] (1 PDB entry) 
Domain d5xhga1: 5xhg A:1-106 [343329]
Other proteins in same PDB: d5xhga2, d5xhgb1, d5xhgb2, d5xhgc2, d5xhgd1, d5xhgd2
automated match to d1dn0a1
complexed with edo, oaz, peg, so4
Details for d5xhga1
PDB Entry: 5xhg (more details), 1.76 Å
PDB Description: crystal structure of trastuzumab fab fragment bearing ne-(o- azidobenzyloxycarbonyl)-l-lysine
PDB Compounds: (A:) polypeptide(L)SCOPe Domain Sequences for d5xhga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xhga1 b.1.1.0 (A:1-106) automated matches {Escherichia coli [TaxId: 316407]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkvei
SCOPe Domain Coordinates for d5xhga1:
Click to download the PDB-style file with coordinates for d5xhga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5xhga1:
View in 3D
