SCOPe 2.08: Domain d5wk3p2: 5wk3 P:113-217

Lineage for d5wk3p2 (5wk3 P:113-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5wk3p2: 5wk3 P:113-217 [343328]
   Other proteins in same PDB: d5wk3a_, d5wk3b_, d5wk3c_, d5wk3d_, d5wk3p1, d5wk3q_, d5wk3r1, d5wk3s_, d5wk3t1, d5wk3u_, d5wk3v1, d5wk3w_
   automated match to d1dn0a2
   complexed with gol

Details for d5wk3p2

PDB Entry: 5wk3, 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab

PDB Compounds: (P:) m116 light chain

SCOPe Domain Sequences for d5wk3p2:

Sequence; same for both SEQRES and ATOM records:

>d5wk3p2 b.1.1.2 (P:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5wk3p2:

• d5wk3p2 first appeared in SCOPe 2.06
  
• d5wk3p2 appears in SCOPe 2.07