SCOPe 2.08: Domain d5y9vb_: 5y9v B:

Lineage for d5y9vb_ (5y9v B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins)
   Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5

6. Protein automated matches [254610] (3 species)
   not a true protein

7. Species Plutella xylostella [TaxId:51655] [343320] (1 PDB entry)

8. Domain d5y9vb_: 5y9v B: [343321]
   automated match to d3hsma_
   complexed with cl, gol

Details for d5y9vb_

PDB Entry: 5y9v, 2.84 Å

PDB Description: crystal structure of diamondback moth ryanodine receptor n-terminal domain

PDB Compounds: (B:) Ryanodine receptor 1

SCOPe Domain Sequences for d5y9vb_:

Sequence, based on SEQRES records:

>d5y9vb_ b.42.6.2 (B:) automated matches {Plutella xylostella [TaxId: 51655]}
vsflrtedmvclsctatgervclaaegfgnrhcfleniqdknippdlsqcvfvieqalsv
ralqelvtaagsetgkgtgsghrtllygnaillrhlnsdmylaclstsssqdklafdvgl
qehsqgeacwwtlhpaskqrsegekvrvgddlilvsvaterylhttkenevsivnasfhv
thwsvqpy

Sequence, based on observed residues (ATOM records):

>d5y9vb_ b.42.6.2 (B:) automated matches {Plutella xylostella [TaxId: 51655]}
vsflrtedmvclsctatgervclaaegfgnrhcfleniqpdlsqcvfvieqalsvralqe
lvthrtllygnaillrhlnsdmylaclstsssqdklafdvglqehsqgeacwwtlhpask
qrsegekvrvgddlilvsvaterylhttkenevsivnasfhvthwsvqpy

Timeline for d5y9vb_:

• d5y9vb_ first appeared in SCOPe 2.06
  
• d5y9vb_ appears in SCOPe 2.07