SCOPe 2.06: Domain d5xafd2: 5xaf D:246-441

Lineage for d5xafd2 (5xaf D:246-441)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)

8. Domain d5xafd2: 5xaf D:246-441 [343312]
   Other proteins in same PDB: d5xafa1, d5xafb1, d5xafc1, d5xafd1, d5xafe_, d5xaff1
   automated match to d3rycd2
   complexed with 84f, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xafd2

PDB Entry: 5xaf, 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z1 complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xafd2:

Sequence, based on SEQRES records:

>d5xafd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d5xafd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

Timeline for d5xafd2:

• d5xafd2 is new in SCOPe 2.06-stable
  
• d5xafd2 appears in SCOPe 2.07
  
• d5xafd2 appears in the current release, SCOPe 2.08