| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries) |
| Domain d5xg0b1: 5xg0 B:1-261 [343304] Other proteins in same PDB: d5xg0a2, d5xg0b2, d5xg0c2 automated match to d4eb0a_ |
PDB Entry: 5xg0 (more details), 1.58 Å
SCOPe Domain Sequences for d5xg0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xg0b1 c.69.1.0 (B:1-261) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygkv
dtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtancs
Timeline for d5xg0b1:
View in 3DDomains from other chains: (mouse over for more information) d5xg0a1, d5xg0a2, d5xg0c1, d5xg0c2 |