Lineage for d1asc__ (1asc -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) 
Family c.67.1.1: AAT-like [53384] (3 proteins) Protein Aspartate aminotransferase, AAT [53385] (6 species) 
Species Escherichia coli [TaxId:562] [53390] (49 PDB entries) 
Domain d1asc__: 1asc - [34330]
Details for d1asc__
PDB Entry: 1asc (more details), 2.4 Å
PDB Description: the structural basis for the reduced activity of the d223a(d222a) active site mutant of e. coli aspartate aminotransferase
SCOP Domain Sequences for d1asc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asc__ c.67.1.1 (-) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfafayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl
SCOP Domain Coordinates for d1asc__:
Click to download the PDB-style file with coordinates for d1asc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1asc__:
- d1asc__ appears in SCOP 1.57
- d1asc__ appears in the current release, SCOPe 2.08, called d1asca_
View in 3D