![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (91 species) not a true protein |
![]() | Species Ideonella sakaiensis [TaxId:1547922] [343272] (5 PDB entries) |
![]() | Domain d5xfza1: 5xfz A:1-261 [343298] Other proteins in same PDB: d5xfza2 automated match to d4eb0a_ complexed with gol, so4; mutant |
PDB Entry: 5xfz (more details), 1.55 Å
SCOPe Domain Sequences for d5xfza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xfza1 c.69.1.0 (A:1-261) automated matches {Ideonella sakaiensis [TaxId: 1547922]} npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalgqvaslngtssspiygkv dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys tfacenpnstrvsdfrtancs
Timeline for d5xfza1: