Lineage for d5xhgc2 (5xhg C:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752527Domain d5xhgc2: 5xhg C:107-214 [343297]
    Other proteins in same PDB: d5xhga1, d5xhgb1, d5xhgb2, d5xhgc1, d5xhgd1, d5xhgd2
    automated match to d1dn0a2
    complexed with edo, oaz, peg, so4

Details for d5xhgc2

PDB Entry: 5xhg (more details), 1.76 Å

PDB Description: crystal structure of trastuzumab fab fragment bearing ne-(o- azidobenzyloxycarbonyl)-l-lysine
PDB Compounds: (C:) polypeptide(L)

SCOPe Domain Sequences for d5xhgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xhgc2 b.1.1.2 (C:107-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalksgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5xhgc2:

Click to download the PDB-style file with coordinates for d5xhgc2.
(The format of our PDB-style files is described here.)

Timeline for d5xhgc2: