SCOPe 2.07: Domain d5m00h1: 5m00 H:1-112

Lineage for d5m00h1 (5m00 H:1-112)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d5m00h1: 5m00 H:1-112 [343284]
Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g2, d5m00h2
automated match to d1nfdb1

Details for d5m00h1

PDB Entry: 5m00 (more details), 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv

PDB Compounds: (H:) T-cell receptor beta chain V region C5,Uncharacterized protein

SCOPe Domain Sequences for d5m00h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m00h1 b.1.1.0 (H:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
gykasrpsqenfslilelaslsqtavyfcassdaggrntlyfgagtrlsvle

SCOPe Domain Coordinates for d5m00h1:

Click to download the PDB-style file with coordinates for d5m00h1.
(The format of our PDB-style files is described here.)

Timeline for d5m00h1: