![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
![]() | Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
![]() | Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
![]() | Protein automated matches [254586] (5 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [343280] (3 PDB entries) |
![]() | Domain d5xt5d_: 5xt5 D: [343281] Other proteins in same PDB: d5xt5a1, d5xt5a2, d5xt5b_ automated match to d1xjsa_ complexed with plp, zn |
PDB Entry: 5xt5 (more details), 2.34 Å
SCOPe Domain Sequences for d5xt5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xt5d_ d.224.1.2 (D:) automated matches {Bacillus subtilis [TaxId: 224308]} nldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfegeg csismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfpar ikcatlswkalekgvak
Timeline for d5xt5d_:
![]() Domains from other chains: (mouse over for more information) d5xt5a1, d5xt5a2, d5xt5b_, d5xt5c_ |