Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5ujth2: 5ujt H:95-190 [343275] Other proteins in same PDB: d5ujta1, d5ujtb1, d5ujtd1, d5ujte1, d5ujtg1, d5ujth1 automated match to d1jk8b1 complexed with nag |
PDB Entry: 5ujt (more details), 1.94 Å
SCOPe Domain Sequences for d5ujth2:
Sequence, based on SEQRES records: (download)
>d5ujth2 b.1.1.2 (H:95-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} veptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwt fqilvmlemtpqrgdvytchvehpslqnpiivewra
>d5ujth2 b.1.1.2 (H:95-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} veptvtispnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmlem tpqrgdvytchvehpslqnpiivewra
Timeline for d5ujth2: